PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G168800.2.p
Common NameSETIT_030441mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 261aa    MW: 27921.8 Da    PI: 9.1189
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G168800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-334195155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
  Seita.2G168800.2.p 41 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 95
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7383898IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-313896IPR009057Homeodomain-like
SuperFamilySSF466891.97E-164197IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-244196IPR006447Myb domain, plants
PfamPF002491.6E-84394IPR001005SANT/Myb domain
PfamPF143799.1E-21136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MFPPGLIHHR PDGPAPGDGA PRSGPGGGPG GPSLVLTADP KPRLRWTADL HERFVDAVAQ  60
LGGPEKATPK TILRTMGVKG LTLFHLKSHL QKYRLGKQSG KEGSEQSKDA SYLLDAQSGM  120
SVSPRVAAQD VKESQEVKEA LRAQMEVQRR LHEQVEVQKR VQIRMEALQK YIDSILESAC  180
KMVTEQFASS GFSISDPDLP EISPGGVMCG PTDTLSSSVF NQLSVSSIDS HSPGGKPSPS  240
GIEGPPMLLQ KSPELKRRSS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956514.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK51e-56APL_ARATH; Myb family transcription factor APL
TrEMBLK3ZV100.0K3ZV10_SETIT; Uncharacterized protein
STRINGSi030441m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-73G2-like family protein